Lineage for d2crba1 (2crb A:8-90)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696503Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2696936Superfamily a.7.16: MIT domain-like [140361] (1 family) (S)
  5. 2696937Family a.7.16.1: MIT domain [140362] (2 proteins)
    this is a repeat family; one repeat unit is 2crb A:8-90 found in domain
  6. 2696938Protein Nuclear receptor binding factor 2, NRBF2, N-terminal domain [140363] (1 species)
  7. 2696939Species Mouse (Mus musculus) [TaxId:10090] [140364] (1 PDB entry)
    Uniprot Q8VCQ3 4-86
  8. 2696940Domain d2crba1: 2crb A:8-90 [130737]
    Other proteins in same PDB: d2crba2, d2crba3

Details for d2crba1

PDB Entry: 2crb (more details)

PDB Description: solution structure of mit domain from mouse nrbf-2
PDB Compounds: (A:) nuclear receptor binding factor 2

SCOPe Domain Sequences for d2crba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
megplnlahqqsrradrllaagkyeeaischrkattylseamklteseqahlslelqrds
hmkqllliqerwkrakreerlka

SCOPe Domain Coordinates for d2crba1:

Click to download the PDB-style file with coordinates for d2crba1.
(The format of our PDB-style files is described here.)

Timeline for d2crba1: