Class b: All beta proteins [48724] (174 folds) |
Fold b.8: TRAF domain-like [49598] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.8.1: TRAF domain-like [49599] (2 families) has a circularly permuted immunoglobulin-fold topology with extra strand |
Family b.8.1.1: MATH domain [49600] (4 proteins) |
Protein Speckle-type poz protein SPOP [141107] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [141108] (7 PDB entries) Uniprot O43791 28-173 |
Domain d2cr2a1: 2cr2 A:8-153 [130732] |
PDB Entry: 2cr2 (more details)
SCOPe Domain Sequences for d2cr2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cr2a1 b.8.1.1 (A:8-153) Speckle-type poz protein SPOP {Human (Homo sapiens) [TaxId: 9606]} kvvkfsymwtinnfsfcreemgeviksstfssgandklkwclrvnpkgldeeskdylsly lllvscpksevrakfkfsilnakgeetkamesqrayrfvqgkdwgfkkfirrdflldean gllpddkltlfcevsvvqdsvnisgq
Timeline for d2cr2a1: