Lineage for d2cp8a1 (2cp8 A:8-48)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696009Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 2696033Superfamily a.5.2: UBA-like [46934] (5 families) (S)
  5. 2696034Family a.5.2.1: UBA domain [46935] (25 proteins)
  6. 2696065Protein Migration-inducing protein 19 NBR1 [140337] (1 species)
    Next to Brca1 gene 1
  7. 2696066Species Human (Homo sapiens) [TaxId:9606] [140338] (1 PDB entry)
    Uniprot Q14596 916-956
  8. 2696067Domain d2cp8a1: 2cp8 A:8-48 [130695]
    Other proteins in same PDB: d2cp8a2, d2cp8a3

Details for d2cp8a1

PDB Entry: 2cp8 (more details)

PDB Description: solution structure of the rsgi ruh-046, a uba domain from human next to brca1 gene 1 protein (kiaa0049 protein) r923h variant
PDB Compounds: (A:) Next to BRCA1 gene 1 protein

SCOPe Domain Sequences for d2cp8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cp8a1 a.5.2.1 (A:8-48) Migration-inducing protein 19 NBR1 {Human (Homo sapiens) [TaxId: 9606]}
qtaalmahlfemgfcdrqlnlrllkkhnynilqvvtellql

SCOPe Domain Coordinates for d2cp8a1:

Click to download the PDB-style file with coordinates for d2cp8a1.
(The format of our PDB-style files is described here.)

Timeline for d2cp8a1: