Lineage for d2cp3a1 (2cp3 A:8-78)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 796060Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 797091Superfamily b.34.10: Cap-Gly domain [74924] (1 family) (S)
  5. 797092Family b.34.10.1: Cap-Gly domain [74925] (10 proteins)
    Pfam PF01302
  6. 797096Protein CLIP-115 [141230] (1 species)
  7. 797097Species Human (Homo sapiens) [TaxId:9606] [141231] (4 PDB entries)
    Uniprot Q9UDT6 219-289! Uniprot Q9UDT6 68-149
  8. 797101Domain d2cp3a1: 2cp3 A:8-78 [130691]
    2nd CAP-Gly domain

Details for d2cp3a1

PDB Entry: 2cp3 (more details)

PDB Description: solution structure of the 2nd cap-gly domain in human clip-115/cyln2
PDB Compounds: (A:) clip-115

SCOP Domain Sequences for d2cp3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cp3a1 b.34.10.1 (A:8-78) CLIP-115 {Human (Homo sapiens) [TaxId: 9606]}
lrlgdrvlvggtktgvvryvgetdfakgewcgveldeplgkndgavagtryfqcppkfgl
fapihkvirig

SCOP Domain Coordinates for d2cp3a1:

Click to download the PDB-style file with coordinates for d2cp3a1.
(The format of our PDB-style files is described here.)

Timeline for d2cp3a1: