Lineage for d2co3a1 (2co3 A:10-142)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1300526Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1300679Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 1300684Family b.2.3.2: Pilus subunits [49405] (9 proteins)
  6. 1300801Protein SafA pilus subunit [141080] (1 species)
  7. 1300802Species Salmonella typhimurium [TaxId:90371] [141081] (4 PDB entries)
    Uniprot Q8ZRK4 36-168! Uniprot Q8ZRK4 46-170
  8. 1300803Domain d2co3a1: 2co3 A:10-142 [130665]
    Other proteins in same PDB: d2co3b_
    forms swapped dimer through the extra N-terminal strand (included)
    mutant

Details for d2co3a1

PDB Entry: 2co3 (more details), 1.78 Å

PDB Description: salmonella enterica safa pilin, head-to-tail swapped dimer of ntd1 mutant
PDB Compounds: (A:) safa pilus subunit

SCOPe Domain Sequences for d2co3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2co3a1 b.2.3.2 (A:10-142) SafA pilus subunit {Salmonella typhimurium [TaxId: 90371]}
qksvdivfsspqdltvslipvsglkagknapsakiaklvvnsttlkefgvrgisnnvvds
tgtawrvagkntgkeigvglssdslrrsdstekwngvnwmtfnsndtldivltgpaqnvt
adtypitldvvgy

SCOPe Domain Coordinates for d2co3a1:

Click to download the PDB-style file with coordinates for d2co3a1.
(The format of our PDB-style files is described here.)

Timeline for d2co3a1: