Lineage for d2cnwd2 (2cnw D:93-303)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) 
division into families based on beta-sheet topologiesFamily c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
core: parallel beta-sheet of 7 strands; order 3241567
Protein automated matches [190304] (16 species)
not a true protein
Species Thermus aquaticus [TaxId:271] [255076] (4 PDB entries) 
Domain d2cnwd2: 2cnw D:93-303 [130656]
Other proteins in same PDB: d2cnwa1, d2cnwa2, d2cnwb1, d2cnwb2, d2cnwc1, d2cnwc2, d2cnwd1, d2cnwe1, d2cnwe2, d2cnwf1
automated match to d1okkd2
protein/RNA complex; complexed with 5gp, alf, gdp, mg
Details for d2cnwd2
PDB Entry: 2cnw (more details), 2.39 Å
PDB Description: gdpalf4 complex of the srp gtpases ffh and ftsy
PDB Compounds: (D:) cell division protein ftsySCOPe Domain Sequences for d2cnwd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cnwd2 c.37.1.10 (D:93-303) automated matches {Thermus aquaticus [TaxId: 271]}
qkpkpvepkgrvvlvvgvngvgktttiaklgryyqnlgkkvmfcagdtfraaggtqlsew
gkrlsipviqgpegtdpaalaydavqamkargydllfvdtagrlhtkhnlmeelkkvkra
iakadpeepkevwlvldavtgqngleqakkfheavgltgvivtkldgtakggvlipivrt
lkvpikfvgvgegpddlqpfdpeafvealle
SCOPe Domain Coordinates for d2cnwd2:
Click to download the PDB-style file with coordinates for d2cnwd2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2cnwd2:
- d2cnwd2 first appeared in SCOP 1.73
- d2cnwd2 appears in SCOPe 2.07
View in 3D
