Lineage for d2cmua1 (2cmu A:3-332)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axisSuperfamily d.126.1: Pentein [55909] (8 families) 
Family d.126.1.6: Porphyromonas-type peptidylarginine deiminase [111155] (3 proteins)
Pfam PF04371; functionally related to the amidinotransferase, similar active site
Protein Putative peptidyl-arginine deiminase [111158] (3 species) 
Species Helicobacter pylori J99 [TaxId:85963] [111159] (2 PDB entries)
Uniprot Q9ZN18
Domain d2cmua1: 2cmu A:3-332 [146414]
Other proteins in same PDB: d2cmua2
Details for d2cmua1
PDB Entry: 2cmu (more details), 2.5 Å
PDB Description: crystal structure of a putative peptidyl-arginine deiminase
PDB Compounds: (A:) putative peptidyl-arginine deiminaseSCOPe Domain Sequences for d2cmua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cmua1 d.126.1.6 (A:3-332) Putative peptidyl-arginine deiminase {Helicobacter pylori J99 [TaxId: 85963]}
lkrmlaefekiqailmafphefsdwaycikearesflniiqtiakhakvlvcvhtndtig
yemlknlpgveiakvdtndtwardfgaisienhgvlecldfgfngwglkypsnldnqvnf
klkslgflkhplktmpyvleggsiesdgagsiltntqclleknrnphlnqngietmlkke
lgakqvlwysygylkgddtdshtdtlarfldkdtivysacedkndehytalkkmqeelkt
fkkldktpyklipleipkaifdenqqrlpatyvnfllcndalivptyndpkdaliletlk
qhtplevigvdcntlikqhgslhcvtmqly
SCOPe Domain Coordinates for d2cmua1:
Click to download the PDB-style file with coordinates for d2cmua1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2cmua1:
- d2cmua1 first appeared in SCOP 1.75
- d2cmua1 appears in SCOPe 2.06
- d2cmua1 appears in the current release, SCOPe 2.08
View in 3D
