Lineage for d2ckhb1 (2ckh B:14-92)
- Root: SCOPe 2.01
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
Superfamily d.15.1: Ubiquitin-like [54236] (9 families) 
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
Pfam PF00240Protein SUMO-2 [117816] (1 species) Species Human (Homo sapiens) [TaxId:9606] [117817] (9 PDB entries)
Uniprot P61956
Domain d2ckhb1: 2ckh B:14-92 [130566]
Other proteins in same PDB: d2ckha1
Details for d2ckhb1
PDB Entry: 2ckh (more details), 3.2 Å
PDB Description: senp1-sumo2 complex
PDB Compounds: (B:) Small ubiquitin-related modifier 2SCOPe Domain Sequences for d2ckhb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ckhb1 d.15.1.1 (B:14-92) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]}
ndhinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirfrfdgqpinetdtpa
qlemededtidvfqqqtgg
SCOPe Domain Coordinates for d2ckhb1:
Click to download the PDB-style file with coordinates for d2ckhb1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2ckhb1:
- d2ckhb1 first appeared in SCOP 1.73
- d2ckhb1 appears in SCOP 1.75
- d2ckhb1 appears in SCOPe 2.02
- d2ckhb1 appears in the current release, SCOPe 2.08
View in 3D
