Lineage for d2cjta1 (2cjt A:1-128)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2772794Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2772795Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) (S)
    two constituent families are related by circular permutation
  5. 2772796Family b.7.1.1: PLC-like (P variant) [49563] (12 proteins)
  6. 2772928Protein Unc-13 homolog A [141105] (1 species)
  7. 2772929Species Norway rat (Rattus norvegicus) [TaxId:10116] [141106] (2 PDB entries)
    Uniprot Q62768 1-128! Uniprot Q62768 2-150
  8. 2772930Domain d2cjta1: 2cjt A:1-128 [130549]
    Other proteins in same PDB: d2cjtb_, d2cjtc_, d2cjtd_
    complexed with edo, fmt
    has additional insertions and/or extensions that are not grouped together

Details for d2cjta1

PDB Entry: 2cjt (more details), 1.44 Å

PDB Description: structural basis for a munc13-1 homodimer - munc13-1 - rim heterodimer switch: c2-domains as versatile protein-protein interaction modules
PDB Compounds: (A:) unc-13 homolog a

SCOPe Domain Sequences for d2cjta1:

Sequence, based on SEQRES records: (download)

>d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Norway rat (Rattus norvegicus) [TaxId: 10116]}
msllcvgvkkakfdgaqekfntyvtlkvqnvksttiavrgsqpsweqdfmfeinrldlgl
tvevwnkgliwdtmvgtvwiplrtirqsneegpgewltldsqaimadseicgtkdptfhr
illdahfe

Sequence, based on observed residues (ATOM records): (download)

>d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Norway rat (Rattus norvegicus) [TaxId: 10116]}
msllcvgvkkakfdgaqekfntyvtlkvqnvksttiavrgsqpsweqdfmfeinrldlgl
tvevwnkgliwdtmvgtvwiplrtirqsneegpgewltldsgtkdptfhrilldahfe

SCOPe Domain Coordinates for d2cjta1:

Click to download the PDB-style file with coordinates for d2cjta1.
(The format of our PDB-style files is described here.)

Timeline for d2cjta1: