Lineage for d2chra2 (2chr A:1-126)
- Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds) 
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
beta(3)-alpha(3); meander and up-and-down bundleSuperfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) 
Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
C-terminal domain is beta/alpha-barrel
Protein Chlormuconate cycloisomerase [54840] (2 species) 
Species Alcaligenes eutrophus [TaxId:106590] [54841] (1 PDB entry) 
Domain d2chra2: 2chr A:1-126 [38895]
Other proteins in same PDB: d2chra1
complexed with cl, mn
Details for d2chra2
PDB Entry: 2chr (more details), 3 Å
PDB Description: a re-evaluation of the crystal structure of chloromuconate cycloisomerase
PDB Compounds: (A:) chloromuconate cycloisomeraseSCOPe Domain Sequences for d2chra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2chra2 d.54.1.1 (A:1-126) Chlormuconate cycloisomerase {Alcaligenes eutrophus [TaxId: 106590]}
mkidaieavivdvptkrpiqmsittvhqqsyvivrvyseglvgvgeggsvggpvwsaeca
etikiiverylaphllgtdafnvsgalqtmaravtgnasakaavemalldlkaralgvsi
aellgg
SCOPe Domain Coordinates for d2chra2:
Click to download the PDB-style file with coordinates for d2chra2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2chra2:
- d2chra2 first appeared (with stable ids) in SCOP 1.55, called d2chr_2
- d2chra2 appears in SCOPe 2.05
- d2chra2 appears in SCOPe 2.07
- d2chra2 appears in the current release, SCOPe 2.08
View in 3D
