Lineage for d2chra1 (2chr A:127-370)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) 
binds metal ion (magnesium or manganese) in conserved site inside barrel
N-terminal alpha+beta domain is common to this superfamily
Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins) 
Protein Chlormuconate cycloisomerase [51619] (2 species) 
Species Alcaligenes eutrophus [TaxId:106590] [51620] (1 PDB entry) 
Domain d2chra1: 2chr A:127-370 [29251]
Other proteins in same PDB: d2chra2
complexed with cl, mn
Details for d2chra1
PDB Entry: 2chr (more details), 3 Å
PDB Description: a re-evaluation of the crystal structure of chloromuconate cycloisomerase
PDB Compounds: (A:) chloromuconate cycloisomeraseSCOPe Domain Sequences for d2chra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2chra1 c.1.11.2 (A:127-370) Chlormuconate cycloisomerase {Alcaligenes eutrophus [TaxId: 106590]}
plrsaipiawtlasgdtkrdldsavemierrrhnrfkvklgfrspqddlihmealsnslg
skaylrvdvnqawdeqvasvyipelealgvelieqpvgrentqalrrlsdnnrvaimade
slstlasafdlardrsvdvfslklcnmggvsatqkiaavaeasgiasyggtmldstigts
valqlystvpslpfgceligpfvladtlshepleirdyelqvptgvghgmtldedkvrqy
arvs
SCOPe Domain Coordinates for d2chra1:
Click to download the PDB-style file with coordinates for d2chra1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2chra1:
- d2chra1 first appeared (with stable ids) in SCOP 1.55, called d2chr_1
- d2chra1 appears in SCOPe 2.07
View in 3D
