Lineage for d2cgza_ (2cgz A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2825187Fold b.154: HPA-like [141085] (1 superfamily)
    sandwich, 6 strands in 2 sheets; jelly-roll (truncated); also includes the pending PCSK9 V domain-like superfamily (the C-terminal domains of 2p4e and 2pmw)
  4. 2825188Superfamily b.154.1: Agglutinin HPA-like [141086] (1 family) (S)
    forms similar trimers to the PCSK9 V domain; strand directions of the subunit beta-sheets are parallel to the three-fold symmetry axis;
  5. 2825189Family b.154.1.1: Agglutinin HPA-like [141087] (2 proteins)
  6. 2825194Protein automated matches [190556] (2 species)
    not a true protein
  7. 2825197Species Roman snail (Helix pomatia) [TaxId:6536] [187541] (2 PDB entries)
  8. 2825198Domain d2cgza_: 2cgz A: [163402]
    automated match to d2ce6a1
    complexed with a2g, nag, ser

Details for d2cgza_

PDB Entry: 2cgz (more details), 2.8 Å

PDB Description: structure of helix pomatia agglutinin with tn antigen
PDB Compounds: (A:) agglutinin

SCOPe Domain Sequences for d2cgza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cgza_ b.154.1.1 (A:) automated matches {Roman snail (Helix pomatia) [TaxId: 6536]}
rvqsgkincgddagwakvpsddpgrdntrelaknitfaspycrppvvllsitqldveqsq
nlrviarlysvsptgfkascytwhntkvysmsiswisien

SCOPe Domain Coordinates for d2cgza_:

Click to download the PDB-style file with coordinates for d2cgza_.
(The format of our PDB-style files is described here.)

Timeline for d2cgza_: