Class b: All beta proteins [48724] (180 folds) |
Fold b.154: HPA-like [141085] (1 superfamily) sandwich, 6 strands in 2 sheets; jelly-roll (truncated); also includes the pending PCSK9 V domain-like superfamily (the C-terminal domains of 2p4e and 2pmw) |
Superfamily b.154.1: Agglutinin HPA-like [141086] (1 family) forms similar trimers to the PCSK9 V domain; strand directions of the subunit beta-sheets are parallel to the three-fold symmetry axis; |
Family b.154.1.1: Agglutinin HPA-like [141087] (2 proteins) |
Protein automated matches [190556] (2 species) not a true protein |
Species Roman snail (Helix pomatia) [TaxId:6536] [187541] (2 PDB entries) |
Domain d2cgza_: 2cgz A: [163402] automated match to d2ce6a1 complexed with a2g, nag, ser |
PDB Entry: 2cgz (more details), 2.8 Å
SCOPe Domain Sequences for d2cgza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cgza_ b.154.1.1 (A:) automated matches {Roman snail (Helix pomatia) [TaxId: 6536]} rvqsgkincgddagwakvpsddpgrdntrelaknitfaspycrppvvllsitqldveqsq nlrviarlysvsptgfkascytwhntkvysmsiswisien
Timeline for d2cgza_: