Lineage for d2cg4a1 (2cg4 A:4-66)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693921Family a.4.5.32: Lrp/AsnC-like transcriptional regulator N-terminal domain [68967] (4 proteins)
    Swapped dimer with the "wing" C-terminal strands
    automatically mapped to Pfam PF13412
  6. 2693946Protein Regulatory protein AsnC [140235] (1 species)
  7. 2693947Species Escherichia coli [TaxId:562] [140236] (1 PDB entry)
    Uniprot P0ACI6 4-66
  8. 2693948Domain d2cg4a1: 2cg4 A:4-66 [130417]
    Other proteins in same PDB: d2cg4a2, d2cg4b2
    complexed with asn, mg

Details for d2cg4a1

PDB Entry: 2cg4 (more details), 2.4 Å

PDB Description: structure of e.coli asnc
PDB Compounds: (A:) regulatory protein asnc

SCOPe Domain Sequences for d2cg4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cg4a1 a.4.5.32 (A:4-66) Regulatory protein AsnC {Escherichia coli [TaxId: 562]}
ylidnldrgilealmgnartayaelakqfgvspetihvrvekmkqagiitgaridvspkq
lgy

SCOPe Domain Coordinates for d2cg4a1:

Click to download the PDB-style file with coordinates for d2cg4a1.
(The format of our PDB-style files is described here.)

Timeline for d2cg4a1:

2693948
d2cg4a1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2cg4a2