Lineage for d2cfoa2 (2cfo A:312-485)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2721147Fold a.97: An anticodon-binding domain of class I aminoacyl-tRNA synthetases [48162] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2721148Superfamily a.97.1: An anticodon-binding domain of class I aminoacyl-tRNA synthetases [48163] (3 families) (S)
  5. 2721175Family a.97.1.0: automated matches [227179] (1 protein)
    not a true family
  6. 2721176Protein automated matches [226898] (7 species)
    not a true protein
  7. 2721187Species Synechococcus elongatus [TaxId:32046] [225114] (1 PDB entry)
  8. 2721188Domain d2cfoa2: 2cfo A:312-485 [203785]
    Other proteins in same PDB: d2cfoa1, d2cfob1, d2cfob3
    automated match to d1j09a1
    protein/RNA complex; complexed with glu

Details for d2cfoa2

PDB Entry: 2cfo (more details), 2.45 Å

PDB Description: non-discriminating glutamyl-trna synthetase from thermosynechococcus elongatus in complex with glu
PDB Compounds: (A:) Glutamyl-tRNA synthetase

SCOPe Domain Sequences for d2cfoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cfoa2 a.97.1.0 (A:312-485) automated matches {Synechococcus elongatus [TaxId: 32046]}
dwdklnwlnrqyiqqlepeeflaeliplwqgagyafdeerdrpwlfdlaqllqpglntlr
eaidqgavffipsvtfdseamaqlgqpqsatilayllehlpaepaltvamgqqliqqaak
aagvkkgatmrtlraaltgavhgpdlmaawqilhqrgwdeprlaaalkqaqtts

SCOPe Domain Coordinates for d2cfoa2:

Click to download the PDB-style file with coordinates for d2cfoa2.
(The format of our PDB-style files is described here.)

Timeline for d2cfoa2:

2721188
d2cfoa2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2cfoa1