Lineage for d2ceva_ (2cev A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. Family c.42.1.1: Arginase-like amidino hydrolases [52769] (5 proteins)
    Pfam PF00491
  6. Protein Arginase [52770] (5 species)
  7. Species Bacillus caldovelox [TaxId:33931] [52772] (5 PDB entries)
  8. Domain d2ceva_: 2cev A: [32576]
    complexed with gai, mn

Details for d2ceva_

PDB Entry: 2cev (more details), 2.15 Å

PDB Description: arginase from bacillus caldevelox, native structure at ph 8.5
PDB Compounds: (A:) protein (arginase)

SCOPe Domain Sequences for d2ceva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ceva_ c.42.1.1 (A:) Arginase {Bacillus caldovelox [TaxId: 33931]}
kpisiigvpmdlgqtrrgvdmgpsamryagvierlerlhydiedlgdipigkaerlheqg
dsrlrnlkavaeaneklaaavdqvvqrgrfplvlggdhsiaigtlagvakhyerlgviwy
dahgdvntaetspsgnihgmplaaslgfghpaltqiggyspkikpehvvligvrsldege
kkfirekgikiytmhevdrlgmtrvmeetiaylkertdgvhlsldldgldpsdapgvgtp
viggltyreshlamemlaeaqiitsaefvevnpildernktasvavalmgslfgeklm

SCOPe Domain Coordinates for d2ceva_ are not available.

Timeline for d2ceva_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2cevb_, d2cevc_, d2cevd_, d2ceve_, d2cevf_