Class a: All alpha proteins [46456] (284 folds) |
Fold a.269: FtsH protease domain-like [140989] (1 superfamily) array of 6 helices and a 2-stranded beta-ribbon |
Superfamily a.269.1: FtsH protease domain-like [140990] (1 family) contains zincin-like (55486) metal-binding motif HExxH, embedded into a topologically different fold automatically mapped to Pfam PF01434 |
Family a.269.1.1: FtsH protease domain-like [140991] (2 proteins) Pfam PF01434; Peptidase family M41 |
Protein Cell division protein FtsH, C-terminal domain [140992] (2 species) |
Species Thermotoga maritima [TaxId:2336] [140994] (2 PDB entries) Uniprot Q9WZ49 411-603 |
Domain d2ce7a1: 2ce7 A:411-603 [130312] Other proteins in same PDB: d2ce7a2, d2ce7b2, d2ce7c2, d2ce7d2, d2ce7e2, d2ce7f2 complexed with adp, mg, zn |
PDB Entry: 2ce7 (more details), 2.44 Å
SCOPe Domain Sequences for d2ce7a1:
Sequence, based on SEQRES records: (download)
>d2ce7a1 a.269.1.1 (A:411-603) Cell division protein FtsH, C-terminal domain {Thermotoga maritima [TaxId: 2336]} lispaekriiayheaghavvstvvpngepvhrisiiprgykalgytlhlpeedkylvsrn elldkltallggraaeevvfgdvtsgaandierateiarnmvcqlgmseelgplawgkee qevflgkeitrlrnyseevaskideevkkivtncyerakeiirkyrkqldniveilleke tiegdelrrilse
>d2ce7a1 a.269.1.1 (A:411-603) Cell division protein FtsH, C-terminal domain {Thermotoga maritima [TaxId: 2336]} lispaekriiayheaghavvstvvpngepvhrisiikylvsrnelldkltallggraaee vvfgdvtsgaandierateiarnmvcqlgmseelgplawgklrnyseevaskideevkki vtncyerakeiirkyrkqldniveilleketiegdelrrilse
Timeline for d2ce7a1: