SCOPe 2.07: Domain d2cchb1: 2cch B:181-308

Lineage for d2cchb1 (2cch B:181-308)

Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds)
Fold a.74: Cyclin-like [47953] (1 superfamily)
core: 5 helices; one helix is surrounded by the others
Superfamily a.74.1: Cyclin-like [47954] (4 families)
duplication: consists of two domains of this fold
Family a.74.1.1: Cyclin [47955] (9 proteins)
Protein Cyclin A [47956] (2 species)
Species Human (Homo sapiens) [TaxId:9606] [47957] (86 PDB entries)
Uniprot P20248 175-432
Domain d2cchb1: 2cch B:181-308 [130237]
Other proteins in same PDB: d2ccha2, d2ccha3, d2cchc2, d2cchc3
automatically matched to d1vin_1
complexed with atp, gol, so4

Details for d2cchb1

PDB Entry: 2cch (more details), 1.7 Å

PDB Description: the crystal structure of cdk2 cyclin a in complex with a substrate peptide derived from cdc modified with a gamma-linked atp analogue

PDB Compounds: (B:) cyclin a2

SCOPe Domain Sequences for d2cchb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cchb1 a.74.1.1 (B:181-308) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
dihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlavnyid
rflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrmehlvlk
vltfdlaa

SCOPe Domain Coordinates for d2cchb1:

Click to download the PDB-style file with coordinates for d2cchb1.
(The format of our PDB-style files is described here.)

Timeline for d2cchb1: