| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (4 families) ![]() duplication: consists of two domains of this fold |
| Family a.74.1.1: Cyclin [47955] (9 proteins) |
| Protein Cyclin A [47956] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [47957] (73 PDB entries) Uniprot P20248 175-432 |
| Domain d2cchb1: 2cch B:181-308 [130237] Other proteins in same PDB: d2ccha_, d2cchc_ automatically matched to d1vin_1 complexed with atp, gol, so4 |
PDB Entry: 2cch (more details), 1.7 Å
SCOPe Domain Sequences for d2cchb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cchb1 a.74.1.1 (B:181-308) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
dihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlavnyid
rflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrmehlvlk
vltfdlaa
Timeline for d2cchb1:
View in 3DDomains from other chains: (mouse over for more information) d2ccha_, d2cchc_, d2cchd1, d2cchd2 |