Lineage for d2ccda2 (2ccd A:433-740)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. Family a.93.1.0: automated matches [191605] (1 protein)
    not a true family
  6. Protein automated matches [191104] (14 species)
    not a true protein
  7. Species Mycobacterium tuberculosis [TaxId:1773] [254876] (5 PDB entries)
  8. Domain d2ccda2: 2ccd A:433-740 [130229]
    automated match to d4c50a2
    complexed with hem; mutant

Details for d2ccda2

PDB Entry: 2ccd (more details), 2.1 Å

PDB Description: crystal structure of the catalase-peroxidase (katg) and s315t mutant from mycobacterium tuberculosis
PDB Compounds: (A:) peroxidase/catalase t

SCOPe Domain Sequences for d2ccda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ccda2 a.93.1.0 (A:433-740) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
kqtllwqdpvpavshdlvgeaeiaslksqirasgltvsqlvstawaaassfrgsdkrgga
nggrirlqpqvgwevndpdgdlrkvirtleeiqesfnsaapgnikvsfadlvvlggcaai
ekaakaaghnitvpftpgrtdasqeqtdvesfavlepkadgfrnylgkgnplpaeymlld
kanlltlsapemtvlvgglrvlganykrlplgvfteasesltndffvnlldmgitwepsp
addgtyqgkdgsgkvkwtgsrvdlvfgsnselralvevygaddaqpkfvqdfvaawdkvm
nldrfdvr

SCOPe Domain Coordinates for d2ccda2 are not available.

Timeline for d2ccda2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ccda1
View in 3D
Domains from other chains:
(mouse over for more information)
d2ccdb1, d2ccdb2