Lineage for d2cc0a1 (2cc0 A:1-192)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (9 families) 
in the different families beta-barrels are similarly distorted but may vary in the number of strands
Family c.6.2.3: NodB-like polysaccharide deacetylase [89559] (7 proteins)
variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=6, S=8; strand order 123456
Protein Acetyl-xylan esterase [141961] (1 species) Species Streptomyces lividans [TaxId:1916] [141962] (1 PDB entry)
Uniprot Q54413 42-233
Domain d2cc0a1: 2cc0 A:1-192 [130209]
Other proteins in same PDB: d2cc0b_
complexed with act, zn
Details for d2cc0a1
PDB Entry: 2cc0 (more details), 1.6 Å
PDB Description: family 4 carbohydrate esterase from streptomyces lividans in complex with acetate
PDB Compounds: (A:) acetyl-xylan esteraseSCOPe Domain Sequences for d2cc0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cc0a1 c.6.2.3 (A:1-192) Acetyl-xylan esterase {Streptomyces lividans [TaxId: 1916]}
aacngyvgltfddgpsgstqsllnalrqnglratmfnqgqyaaqnpslvraqvdagmwva
nhsythphmtqlgqaqmdseisrtqqaiagagggtpklfrppygetnatlrsveakyglt
eviwdvdsqdwnnastdaivqavsrlgngqvilmhdwpantlaaipriaqtlagkglcsg
mispqtgravap
SCOPe Domain Coordinates for d2cc0a1:
Click to download the PDB-style file with coordinates for d2cc0a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2cc0a1:
- d2cc0a1 first appeared in SCOP 1.73
- d2cc0a1 appears in SCOPe 2.07
View in 3D
