Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (54 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [187022] (11 PDB entries) |
Domain d2cbyd_: 2cby D: [130205] Other proteins in same PDB: d2cbya1 automated match to d1tyfa_ |
PDB Entry: 2cby (more details), 2.6 Å
SCOPe Domain Sequences for d2cbyd_:
Sequence, based on SEQRES records: (download)
>d2cbyd_ c.14.1.0 (D:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} sltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdislyinspggsisag maiydtmvlapcdiatyamgmaasmgefllaagtkgkryalpharilmhqplggvtgsaa diaiqaeqfavikkemfrlnaeftgqpierieadsdrdrwftaaealeygfvdhiitrah v
>d2cbyd_ c.14.1.0 (D:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} sltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdislyinspggsisag maiydtmvlapcdiatyamgmaasmgefllaagtkgkryalpharilmhqpiaiqaeqfa vikkemfrlnaeftgqpierieadsdrdrwftaaealeygfvdhiitrahv
Timeline for d2cbyd_: