Class a: All alpha proteins [46456] (289 folds) |
Fold a.48: N-cbl like [47667] (5 superfamilies) 4 helices; bundle, left-handed twist; left-handed superhelix |
Superfamily a.48.1: N-terminal domain of cbl (N-cbl) [47668] (2 families) automatically mapped to Pfam PF02262 |
Family a.48.1.1: N-terminal domain of cbl (N-cbl) [47669] (1 protein) |
Protein N-terminal domain of cbl (N-cbl) [47670] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [47671] (13 PDB entries) |
Domain d2cbla2: 2cbl A:47-177 [17774] Other proteins in same PDB: d2cbla1, d2cbla3 complexed with ca |
PDB Entry: 2cbl (more details), 2.1 Å
SCOPe Domain Sequences for d2cbla2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cbla2 a.48.1.1 (A:47-177) N-terminal domain of cbl (N-cbl) {Human (Homo sapiens) [TaxId: 9606]} ppgtvdkkmvekcwklmdkvvrlcqnpklalknsppyildllpdtyqhlrtilsryegkm etlgeneyfrvfmenlmkktkqtislfkegkermyeensqprrnltklslifshmlaelk gifpsglfqgd
Timeline for d2cbla2: