Class g: Small proteins [56992] (100 folds) |
Fold g.8: BPTI-like [57361] (1 superfamily) disulfide-rich alpha+beta fold |
Superfamily g.8.1: BPTI-like [57362] (4 families) |
Family g.8.1.0: automated matches [191505] (1 protein) not a true family |
Protein automated matches [190829] (14 species) not a true protein |
Species Conus striatus [TaxId:6493] [255085] (5 PDB entries) |
Domain d2ca7a_: 2ca7 A: [241444] automated match to d3byba_ |
PDB Entry: 2ca7 (more details)
SCOPe Domain Sequences for d2ca7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ca7a_ g.8.1.0 (A:) automated matches {Conus striatus [TaxId: 6493]} kdrpslcdlpadsgsgtkaekriyynsarkqclrfdytgqggnennfrrtydcqrtclyt
Timeline for d2ca7a_: