Lineage for d2ca7a_ (2ca7 A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032519Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 3032520Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 3032807Family g.8.1.0: automated matches [191505] (1 protein)
    not a true family
  6. 3032808Protein automated matches [190829] (14 species)
    not a true protein
  7. 3032813Species Conus striatus [TaxId:6493] [255085] (5 PDB entries)
  8. 3032820Domain d2ca7a_: 2ca7 A: [241444]
    automated match to d3byba_

Details for d2ca7a_

PDB Entry: 2ca7 (more details)

PDB Description: conkunitzin-s1 is the first member of a new kunitz-type neurotoxin family- structural and functional characterization
PDB Compounds: (A:) conkunitzin-s1

SCOPe Domain Sequences for d2ca7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ca7a_ g.8.1.0 (A:) automated matches {Conus striatus [TaxId: 6493]}
kdrpslcdlpadsgsgtkaekriyynsarkqclrfdytgqggnennfrrtydcqrtclyt

SCOPe Domain Coordinates for d2ca7a_:

Click to download the PDB-style file with coordinates for d2ca7a_.
(The format of our PDB-style files is described here.)

Timeline for d2ca7a_: