Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
Protein automated matches [190151] (166 species) not a true protein |
Species Bacillus circulans [TaxId:1397] [187516] (3 PDB entries) |
Domain d2c7ta_: 2c7t A: [163289] automated match to d1b9ha_ complexed with plp, so4 |
PDB Entry: 2c7t (more details), 2.1 Å
SCOPe Domain Sequences for d2c7ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c7ta_ c.67.1.0 (A:) automated matches {Bacillus circulans [TaxId: 1397]} dhwpewpqhsdrtrrkieevfqsnrwaisgywtgeesmerkfakafadfngvpycvptts gstalmlalealgigegdevivpsltwiatatavlnvnalpvfvdveadtycidpqliks aitdktkaiipvhlfgsmanmdeineiaqehnlfviedcaqshgsvwnnqragtigdiga fscqqgkvltageggiivtknprlfeliqqlradsrvycddsselmhgdmqlvkkgdiqg snyclsefqsailldqlqelddknaireknamflndalskidgikvmkrppqvsrqtyyg yvfrfdpvkfgglnadqfceilreklnmgtfylhppylpvhknplfcpwtknrylksvrk teaywrglhypvserasgqsivihhaillaepshlsllvdavaelarkfcvt
Timeline for d2c7ta_: