Lineage for d2c7lb_ (2c7l B:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies)
core: 6 helices; folded leaf, partly openedSuperfamily a.1.1: Globin-like [46458] (5 families) 
Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
binds a bilin chromophore
automatically mapped to Pfam PF00502
Protein automated matches [190531] (23 species)
not a true protein
Species Mastigocladus laminosus [TaxId:83541] [187515] (3 PDB entries) 
Domain d2c7lb_: 2c7l B: [163288]
automated match to d1i7yb_
complexed with bla, cyc
Details for d2c7lb_
PDB Entry: 2c7l (more details), 2.85 Å
PDB Description: low temperature structure of phycoerythrocyanin from mastigocladus laminosus
PDB Compounds: (B:) phycoerythrocyanin beta chainSCOPe Domain Sequences for d2c7lb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c7lb_ a.1.1.3 (B:) automated matches {Mastigocladus laminosus [TaxId: 83541]}
mldafsrvveqadkkgaylsndeinalqaivadsnkrldvvnrltsnassivanayralv
aerpqvfnpggpcfhhrnqaacirdlgfilryvtysvlagdtsvmddrclnglretyqal
gtpgdavasgikkmkeaalkiandpngitkgdcsqlmselasyfdraaaava
SCOPe Domain Coordinates for d2c7lb_:
Click to download the PDB-style file with coordinates for d2c7lb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2c7lb_:
- d2c7lb_ first appeared in SCOPe 2.01
- d2c7lb_ appears in SCOPe 2.07
View in 3D
