SCOPe 2.05: Domain d2c7fa1: 2c7f A:2-16,A:387-502

Lineage for d2c7fa1 (2c7f A:2-16,A:387-502)

Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds)
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
folded sheet; greek-key
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
this domain is C-terminal to the catalytic beta/alpha barrel domain
Family b.71.1.2: Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 [89388] (4 proteins)
interrupted by the catalytic domain; the C-terminal core is similar to the alpha-amylase domain
Protein Alpha-l-arabinofuranosidase [101924] (2 species)
glycosyl hydrolase family 51
Species Clostridium thermocellum [TaxId:1515] [141554] (2 PDB entries)
Uniprot Q4CJG5 2-16,387-502
Domain d2c7fa1: 2c7f A:2-16,A:387-502 [130055]
Other proteins in same PDB: d2c7fa2, d2c7fb2, d2c7fc2, d2c7fd2, d2c7fe2, d2c7ff2
complexed with edo

Details for d2c7fa1

PDB Entry: 2c7f (more details), 2.7 Å

PDB Description: the structure of a family 51 arabinofuranosidase, araf51, from clostridium thermocellum in complex with 1,5-alpha-l-arabinotriose.

PDB Compounds: (A:) alpha-l-arabinofuranosidase

SCOPe Domain Sequences for d2c7fa1:

Sequence, based on SEQRES records: (download)

>d2c7fa1 b.71.1.2 (A:2-16,A:387-502) Alpha-l-arabinofuranosidase {Clostridium thermocellum [TaxId: 1515]}
kkarmtvdkdykiaeXgivlqpvinsplhdtskhedvtdiesvaiyneekeevtifavnr
nihedivlvsdvrgmkdyrllehivlehqdlkirnsvngeevypknsdkssfddgiltsm
lrraswnvirig

Sequence, based on observed residues (ATOM records): (download)

>d2c7fa1 b.71.1.2 (A:2-16,A:387-502) Alpha-l-arabinofuranosidase {Clostridium thermocellum [TaxId: 1515]}
kkarmtvdkdykiaeXgivlqpvinsplhdtskhedvtdiesvaiyneekeevtifavnr
nihedivlvsdvrgmrllehivlehqdlkirnsvngeevypknsdkfddgiltsmlrras
wnvirig

SCOPe Domain Coordinates for d2c7fa1:

Click to download the PDB-style file with coordinates for d2c7fa1.
(The format of our PDB-style files is described here.)

Timeline for d2c7fa1: