Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.61.1: PRTase-like [53271] (3 families) |
Family c.61.1.2: Phosphoribosylpyrophosphate synthetase-like [53296] (2 proteins) duplication: consists of two domains of this fold |
Protein PRPP synthetase-associated protein 1 [142563] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [142564] (1 PDB entry) Uniprot Q14558 167-350! Uniprot Q14558 7-166 |
Domain d2c4ka1: 2c4k A:7-166 [129824] complexed with so4, tam |
PDB Entry: 2c4k (more details), 2.65 Å
SCOPe Domain Sequences for d2c4ka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c4ka1 c.61.1.2 (A:7-166) PRPP synthetase-associated protein 1 {Human (Homo sapiens) [TaxId: 9606]} gyrvfsanstaactelakriterlgaelgksvvyqetngetrveikesvrgqdifiiqti prdvntavmellimayalktacarniigvipyfpyskqskmrkrgsivckllasmlakag lthiitmdlhqkeiqgffsfpvdnlraspfllqyiqeeip
Timeline for d2c4ka1: