SCOPe 2.08: Domain d2c4ka1: 2c4k A:7-166

Lineage for d2c4ka1 (2c4k A:7-166)

Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
Fold c.61: PRTase-like [53270] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
Superfamily c.61.1: PRTase-like [53271] (3 families)
Family c.61.1.2: Phosphoribosylpyrophosphate synthetase-like [53296] (2 proteins)
duplication: consists of two domains of this fold
Protein PRPP synthetase-associated protein 1 [142563] (1 species)
Species Human (Homo sapiens) [TaxId:9606] [142564] (1 PDB entry)
Uniprot Q14558 167-350! Uniprot Q14558 7-166
Domain d2c4ka1: 2c4k A:7-166 [129824]
complexed with so4, tam

Details for d2c4ka1

PDB Entry: 2c4k (more details), 2.65 Å

PDB Description: crystal structure of human phosphoribosylpyrophosphate synthetase- associated protein 39 (pap39)

PDB Compounds: (A:) phosphoribosyl pyrophosphate synthetase-associated protein 1

SCOPe Domain Sequences for d2c4ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c4ka1 c.61.1.2 (A:7-166) PRPP synthetase-associated protein 1 {Human (Homo sapiens) [TaxId: 9606]}
gyrvfsanstaactelakriterlgaelgksvvyqetngetrveikesvrgqdifiiqti
prdvntavmellimayalktacarniigvipyfpyskqskmrkrgsivckllasmlakag
lthiitmdlhqkeiqgffsfpvdnlraspfllqyiqeeip

SCOPe Domain Coordinates for d2c4ka1:

Click to download the PDB-style file with coordinates for d2c4ka1.
(The format of our PDB-style files is described here.)

Timeline for d2c4ka1: