Lineage for d2c35b1 (2c35 B:78-171)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.40: OB-fold [50198] (17 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) 
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (32 proteins)
barrel, closed; n=5, S=8
Protein C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) [88670] (3 species) 
Species Human (Homo sapiens) [TaxId:9606] [141309] (1 PDB entry)
Uniprot P62487 78-171
Domain d2c35b1: 2c35 B:78-171 [129712]
Other proteins in same PDB: d2c35a1, d2c35b2, d2c35c_, d2c35d2, d2c35e_, d2c35f2, d2c35g_, d2c35h2
Details for d2c35b1
PDB Entry: 2c35 (more details), 2.7 Å
PDB Description: subunits rpb4 and rpb7 of human rna polymerase ii
PDB Compounds: (B:) DNA-directed RNA polymerase II 19 kDa polypeptideSCOPe Domain Sequences for d2c35b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c35b1 b.40.4.5 (B:78-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Human (Homo sapiens) [TaxId: 9606]}
rpfkgevvdavvtqvnkvglfteigpmscfisrhsipsemefdpnsnppcyktmdedivi
qqddeirlkivgtrvdkndifaigslmddylglv
SCOPe Domain Coordinates for d2c35b1:
Click to download the PDB-style file with coordinates for d2c35b1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2c35b1:
- d2c35b1 first appeared in SCOP 1.73
- d2c35b1 appears in SCOPe 2.06
- d2c35b1 appears in the current release, SCOPe 2.08
View in 3D
