Lineage for d2c31a1 (2c31 A:195-369)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470834Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2470835Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2470886Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins)
    N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold
  6. 2471057Protein Oxalyl-CoA decarboxylase [142124] (1 species)
  7. 2471058Species Oxalobacter formigenes [TaxId:847] [142125] (6 PDB entries)
    Uniprot P40149 195-369
  8. 2471061Domain d2c31a1: 2c31 A:195-369 [129704]
    Other proteins in same PDB: d2c31a2, d2c31a3, d2c31b2, d2c31b3
    complexed with adp, mg, tzd

Details for d2c31a1

PDB Entry: 2c31 (more details), 1.73 Å

PDB Description: crystal structure of oxalyl-coa decarboxylase in complex with the cofactor derivative thiamin-2-thiazolone diphosphate and adenosine diphosphate
PDB Compounds: (A:) oxalyl-coa decarboxylase

SCOPe Domain Sequences for d2c31a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c31a1 c.31.1.3 (A:195-369) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]}
aqipaedaiaraadliknakrpvimlgkgaayaqcddeiralveetgipflpmgmakgll
pdnhpqsaaatrafalaqcdvcvligarlnwlmqhgkgktwgdelkkyvqidiqanemds
nqpiaapvvgdiksavsllrkalkgapkadaewtgalkakvdgnkaklagkmtae

SCOPe Domain Coordinates for d2c31a1:

Click to download the PDB-style file with coordinates for d2c31a1.
(The format of our PDB-style files is described here.)

Timeline for d2c31a1: