Lineage for d2c1ca1 (2c1c A:7-309)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2495627Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2497307Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 2497308Family c.56.5.1: Pancreatic carboxypeptidases [53188] (5 proteins)
  6. 2497375Protein Carboxypeptidase B [53193] (4 species)
  7. 2497376Species Corn earworm (Helicoverpa zea) [TaxId:7113] [142511] (1 PDB entry)
    Uniprot Q3T905 117-428
  8. 2497377Domain d2c1ca1: 2c1c A:7-309 [129630]
    complexed with y1, zn

Details for d2c1ca1

PDB Entry: 2c1c (more details), 2.3 Å

PDB Description: Structural basis of the resistance of an insect carboxypeptidase to plant protease inhibitors
PDB Compounds: (A:) carboxypeptidase b

SCOPe Domain Sequences for d2c1ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c1ca1 c.56.5.1 (A:7-309) Carboxypeptidase B {Corn earworm (Helicoverpa zea) [TaxId: 7113]}
lpydnyqelevideyldyigekypdvatvvnaaesfegrpikyikisttnfedenkpvif
idggiharewisppsvtwaihklvedvtendllekfdwillpvvnpdgykytftnerfwr
ktrstnnnplsqicrgadgnrnfdfvwnsigtsnspcsdiyagtsafsevetrvvrdilh
ehlarmalyltmhsfgsmilypwghdgslsqnalglhtvgvamasviqsnalpnfppytv
gnsalvigyyiagssedyahsigvplsytyelpglssgwdgfhlppqyieqvcretwegi
vvgarragdlfr

SCOPe Domain Coordinates for d2c1ca1:

Click to download the PDB-style file with coordinates for d2c1ca1.
(The format of our PDB-style files is described here.)

Timeline for d2c1ca1: