Lineage for d2c1ca1 (2c1c A:7-309)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loopsSuperfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) 
core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
Family c.56.5.1: Pancreatic carboxypeptidases [53188] (5 proteins) 
Protein Carboxypeptidase B [53193] (4 species) 
Species Corn earworm (Helicoverpa zea) [TaxId:7113] [142511] (1 PDB entry)
Uniprot Q3T905 117-428
Domain d2c1ca1: 2c1c A:7-309 [129630]
complexed with y1, zn
Details for d2c1ca1
PDB Entry: 2c1c (more details), 2.3 Å
PDB Description: Structural basis of the resistance of an insect carboxypeptidase to plant protease inhibitors
PDB Compounds: (A:) carboxypeptidase bSCOPe Domain Sequences for d2c1ca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c1ca1 c.56.5.1 (A:7-309) Carboxypeptidase B {Corn earworm (Helicoverpa zea) [TaxId: 7113]}
lpydnyqelevideyldyigekypdvatvvnaaesfegrpikyikisttnfedenkpvif
idggiharewisppsvtwaihklvedvtendllekfdwillpvvnpdgykytftnerfwr
ktrstnnnplsqicrgadgnrnfdfvwnsigtsnspcsdiyagtsafsevetrvvrdilh
ehlarmalyltmhsfgsmilypwghdgslsqnalglhtvgvamasviqsnalpnfppytv
gnsalvigyyiagssedyahsigvplsytyelpglssgwdgfhlppqyieqvcretwegi
vvgarragdlfr
SCOPe Domain Coordinates for d2c1ca1:
Click to download the PDB-style file with coordinates for d2c1ca1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2c1ca1:
- d2c1ca1 first appeared in SCOP 1.73
- d2c1ca1 appears in SCOPe 2.07
View in 3D
