Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds) |
Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily) 2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology |
Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles) |
Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (10 proteins) |
Protein Nitroalkane oxidase [144026] (1 species) |
Species Fungus (Fusarium oxysporum) [TaxId:5507] [144027] (4 PDB entries) Uniprot Q8X1D8 2-260 |
Domain d2c0ua2: 2c0u A:2-260 [129608] Other proteins in same PDB: d2c0ua1, d2c0ub1, d2c0uc1, d2c0ud1 complexed with fad, nbt |
PDB Entry: 2c0u (more details), 2.2 Å
SCOPe Domain Sequences for d2c0ua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c0ua2 e.6.1.1 (A:2-260) Nitroalkane oxidase {Fungus (Fusarium oxysporum) [TaxId: 5507]} vdfklspsqlearrhaqafantvltkasaeystqkdqlsrfqatrpfyreavrhglikaq vpiplggtmeslvhesiileelfavepatsitivatalglmpvilcdspslqekflkpfi sgegeplaslmhsepngtanwlqkggpglqttarkvgnewvisgeklwpsnsggwdykga dlacvvcrvsddpskpqdpnvdpatqiavllvtretiannkkdayqilgepelaghitts gphtrftefhvphenllct
Timeline for d2c0ua2: