Lineage for d2bzea1 (2bze A:345-476)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.34: SH3-like barrel [50036] (21 superfamilies)
barrel, partly opened; n*=4, S*=8; meander
the last strand is interrupted by a turn of 3-10 helix
Superfamily b.34.21: Plus3-like [159042] (1 family) 
automatically mapped to Pfam PF03126Family b.34.21.1: Plus3 [159043] (2 proteins)
Pfam PF03126Protein RNA polymerase-associated protein RTF1 homolog [159044] (1 species) Species Human (Homo sapiens) [TaxId:9606] [159045] (3 PDB entries)
Uniprot Q92541 307-442! Uniprot Q92541 313-444
Domain d2bzea1: 2bze A:345-476 [146224]
Other proteins in same PDB: d2bzea2
Details for d2bzea1
PDB Entry: 2bze (more details)
PDB Description: nmr structure of human rtf1 plus3 domain.
PDB Compounds: (A:) kiaa0252 proteinSCOPe Domain Sequences for d2bzea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bzea1 b.34.21.1 (A:345-476) RNA polymerase-associated protein RTF1 homolog {Human (Homo sapiens) [TaxId: 9606]}
vslpeelnrvrlsrhklerwchmpffaktvtgcfvrigignhnskpvyrvaeitgvveta
kvyqlggtrtnkglqlrhgndqrvfrlefvsnqeftesefmkwkeamfsagmqlptldei
nkkelsikealn
SCOPe Domain Coordinates for d2bzea1:
Click to download the PDB-style file with coordinates for d2bzea1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2bzea1:
- d2bzea1 first appeared in SCOP 1.75
- d2bzea1 appears in SCOPe 2.07
View in 3D
