Lineage for d2bwfa_ (2bwf A:)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) 
Family d.15.1.0: automated matches [191343] (1 protein)
not a true familyProtein automated matches [190233] (31 species)
not a true protein
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [186998] (8 PDB entries) 
Domain d2bwfa_: 2bwf A: [129363]
automated match to d1bt0a_
complexed with fmt
Details for d2bwfa_
PDB Entry: 2bwf (more details), 1.15 Å
PDB Description: crystal structure of the ubl domain of dsk2 from s. cerevisiae
PDB Compounds: (A:) ubiquitin-like protein dsk2SCOPe Domain Sequences for d2bwfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bwfa_ d.15.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ldmslnihiksgqdkwevnvapestvlqfkeainkangipvanqrliysgkilkddqtve
syhiqdghsvhlvksqp
SCOPe Domain Coordinates for d2bwfa_:
Click to download the PDB-style file with coordinates for d2bwfa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2bwfa_:
- d2bwfa_ first appeared in SCOP 1.73, called d2bwfa1
- d2bwfa_ appears in SCOPe 2.06
- d2bwfa_ appears in the current release, SCOPe 2.08
View in 3D
