Lineage for d2bv6a1 (2bv6 A:5-140)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1478534Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1479238Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. 1479313Protein Transcriptional regulator MgrA [158272] (1 species)
  7. 1479314Species Staphylococcus aureus [TaxId:1280] [158273] (1 PDB entry)
    Uniprot Q7A1J9 6-141
  8. 1479315Domain d2bv6a1: 2bv6 A:5-140 [146218]
    complexed with so4

Details for d2bv6a1

PDB Entry: 2bv6 (more details), 2.8 Å

PDB Description: crystal structure of mgra, a global regulator and major virulence determinant in staphylococcus aureus
PDB Compounds: (A:) hth-type transcriptional regulator mgra

SCOPe Domain Sequences for d2bv6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bv6a1 a.4.5.28 (A:5-140) Transcriptional regulator MgrA {Staphylococcus aureus [TaxId: 1280]}
mnlkeqlcfslynaqrqvnryysnkvfkkynltypqflvltilwdespvnvkkvvtelal
dtgtvspllkrmeqvdlikrersevdqrevfihltdksetirpelsnasdkvasasslsq
devkelnrllgkviha

SCOPe Domain Coordinates for d2bv6a1:

Click to download the PDB-style file with coordinates for d2bv6a1.
(The format of our PDB-style files is described here.)

Timeline for d2bv6a1: