Lineage for d2bv1a_ (2bv1 A:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
multihelical; consists of two all-alpha subdomains
contains a 4-helical bundle with left-handed twist and up-and-down topologySuperfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) 
Family a.91.1.0: automated matches [191379] (1 protein)
not a true familyProtein automated matches [190464] (3 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [187381] (38 PDB entries) 
Domain d2bv1a_: 2bv1 A: [163167]
automated match to d2jm5a1
Details for d2bv1a_
PDB Entry: 2bv1 (more details), 2 Å
PDB Description: regulator of g-protein signalling 1 (human)
PDB Compounds: (A:) regulator of g-protein signalling 1SCOPe Domain Sequences for d2bv1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bv1a_ a.91.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kdvlsaaevmqwsqslekllanqtgqnvfgsflksefseeniefwlacedykktesdllp
ckaeeiykafvhsdaakqinidfrtrestakkikaptptcfdeaqkviytlmekdsyprf
lksdiylnllndlq
SCOPe Domain Coordinates for d2bv1a_:
Click to download the PDB-style file with coordinates for d2bv1a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2bv1a_:
- d2bv1a_ first appeared in SCOPe 2.01
- d2bv1a_ appears in SCOPe 2.07
View in 3D
