Lineage for d2bu8a2 (2bu8 A:170-376)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
8-stranded mixed beta-sheet; 2 layers: alpha/betaSuperfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) 
Family d.122.1.4: alpha-ketoacid dehydrogenase kinase, C-terminal domain [69804] (3 proteins) 
Protein automated matches [230554] (2 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [230555] (8 PDB entries) 
Domain d2bu8a2: 2bu8 A:170-376 [230556]
Other proteins in same PDB: d2bu8a1
automated match to d1jm6a2
complexed with adp, mg, tf4
Details for d2bu8a2
PDB Entry: 2bu8 (more details), 2.5 Å
PDB Description: crystal structures of human pyruvate dehydrogenase kinase 2 containing physiological and synthetic ligands
PDB Compounds: (A:) pyruvate dehydrogenase kinase isoenzyme 2SCOPe Domain Sequences for d2bu8a2:
Sequence, based on SEQRES records: (download)
>d2bu8a2 d.122.1.4 (A:170-376) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gstnpahpkhigsidpncnvsevvkdaydmakllcdkyymaspdleiqeinaanskqpih
mvyvpshlyhmlfelfknamratveshesslilppikvmvalgeedlsikmsdrgggvpl
rkierlfsymystaptpqpgtggtplagfgyglpisrlyakyfqgdlqlfsmegfgtdav
iylkalstdsverlpvynksawrhyqt
Sequence, based on observed residues (ATOM records): (download)
>d2bu8a2 d.122.1.4 (A:170-376) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gstnpahpkhigsidpncnvsevvkdaydmakllcdkyymaspdleiqeinaanskqpih
mvyvpshlyhmlfelfknamratveshesslilppikvmvalgeedlsikmsdrgggvpl
rkierlfsymystplagfgyglpisrlyakyfqgdlqlfsmegfgtdaviylkalstdsv
erlpvynksawrhyqt
SCOPe Domain Coordinates for d2bu8a2:
Click to download the PDB-style file with coordinates for d2bu8a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2bu8a2:
- d2bu8a2 first appeared in SCOPe 2.03
- d2bu8a2 appears in SCOPe 2.06
- d2bu8a2 appears in the current release, SCOPe 2.08
View in 3D
