Lineage for d2bu8a2 (2bu8 A:170-376)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2973214Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2973215Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2973930Family d.122.1.4: alpha-ketoacid dehydrogenase kinase, C-terminal domain [69804] (3 proteins)
  6. 2973980Protein automated matches [230554] (2 species)
    not a true protein
  7. 2973981Species Human (Homo sapiens) [TaxId:9606] [230555] (8 PDB entries)
  8. 2973988Domain d2bu8a2: 2bu8 A:170-376 [230556]
    Other proteins in same PDB: d2bu8a1
    automated match to d1jm6a2
    complexed with adp, mg, tf4

Details for d2bu8a2

PDB Entry: 2bu8 (more details), 2.5 Å

PDB Description: crystal structures of human pyruvate dehydrogenase kinase 2 containing physiological and synthetic ligands
PDB Compounds: (A:) pyruvate dehydrogenase kinase isoenzyme 2

SCOPe Domain Sequences for d2bu8a2:

Sequence, based on SEQRES records: (download)

>d2bu8a2 d.122.1.4 (A:170-376) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gstnpahpkhigsidpncnvsevvkdaydmakllcdkyymaspdleiqeinaanskqpih
mvyvpshlyhmlfelfknamratveshesslilppikvmvalgeedlsikmsdrgggvpl
rkierlfsymystaptpqpgtggtplagfgyglpisrlyakyfqgdlqlfsmegfgtdav
iylkalstdsverlpvynksawrhyqt

Sequence, based on observed residues (ATOM records): (download)

>d2bu8a2 d.122.1.4 (A:170-376) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gstnpahpkhigsidpncnvsevvkdaydmakllcdkyymaspdleiqeinaanskqpih
mvyvpshlyhmlfelfknamratveshesslilppikvmvalgeedlsikmsdrgggvpl
rkierlfsymystplagfgyglpisrlyakyfqgdlqlfsmegfgtdaviylkalstdsv
erlpvynksawrhyqt

SCOPe Domain Coordinates for d2bu8a2:

Click to download the PDB-style file with coordinates for d2bu8a2.
(The format of our PDB-style files is described here.)

Timeline for d2bu8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bu8a1