Lineage for d2btua1 (2btu A:13-167)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families) (S)
  5. Family d.79.4.0: automated matches [227181] (1 protein)
    not a true family
  6. Protein automated matches [226901] (10 species)
    not a true protein
  7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [225122] (1 PDB entry)
  8. Domain d2btua1: 2btu A:13-167 [203634]
    Other proteins in same PDB: d2btua2, d2btub2
    automated match to d1clia1

Details for d2btua1

PDB Entry: 2btu (more details), 2.3099999999999996 Å

PDB Description: crystal structure of phosphoribosylformylglycinamidine cyclo-ligase from bacillus anthracis at 2.3a resolution.
PDB Compounds: (A:) phosphoribosyl-aminoimidazole synthetase

SCOPe Domain Sequences for d2btua1:

Sequence, based on SEQRES records: (download)

>d2btua1 d.79.4.0 (A:13-167) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
eagyeavsrmkkhvqttmrkevlgglggfggmfdlskfaleepvlvsgtdgvgtklmlaf
madkhdtigidavamcvndivvqgaeplffldyiacgkaepskienivkgisegcrqagc
aliggetaempgmysteeydlagftvgivdkkkiv

Sequence, based on observed residues (ATOM records): (download)

>d2btua1 d.79.4.0 (A:13-167) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
eagyeavsrmkkhvqttmrkevlggfggmfdlskfaleepvlvsgtdgvgtklmlafmad
khdtigidavamcvndivvqgaeplffldyiacgkaepskienivkgisegcrqagcali
ggetaempgmysteeydlagftvgivdkkkiv

SCOPe Domain Coordinates for d2btua1 are not available.

Timeline for d2btua1:

Domains from same chain:
(mouse over for more information)
d2btua2
Domains from other chains:
(mouse over for more information)
d2btub1, d2btub2