Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families) |
Family d.79.4.0: automated matches [227181] (1 protein) not a true family |
Protein automated matches [226901] (10 species) not a true protein |
Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [225122] (1 PDB entry) |
Domain d2btua1: 2btu A:13-167 [203634] Other proteins in same PDB: d2btua2, d2btub2 automated match to d1clia1 |
PDB Entry: 2btu (more details), 2.31 Å
SCOPe Domain Sequences for d2btua1:
Sequence, based on SEQRES records: (download)
>d2btua1 d.79.4.0 (A:13-167) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} eagyeavsrmkkhvqttmrkevlgglggfggmfdlskfaleepvlvsgtdgvgtklmlaf madkhdtigidavamcvndivvqgaeplffldyiacgkaepskienivkgisegcrqagc aliggetaempgmysteeydlagftvgivdkkkiv
>d2btua1 d.79.4.0 (A:13-167) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} eagyeavsrmkkhvqttmrkevlggfggmfdlskfaleepvlvsgtdgvgtklmlafmad khdtigidavamcvndivvqgaeplffldyiacgkaepskienivkgisegcrqagcali ggetaempgmysteeydlagftvgivdkkkiv
Timeline for d2btua1: