Lineage for d2btoa2 (2bto A:253-432)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) 
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) 
Protein Tubulin alpha-subunit [55311] (3 species) Species Prosthecobacter dejongeii [TaxId:48465] [160500] (2 PDB entries)
Uniprot Q8GCC5 253-432
bacterial tubulin BtubA
Domain d2btoa2: 2bto A:253-432 [145010]
Other proteins in same PDB: d2btoa1, d2btob1, d2btot_
complexed with gtp
Details for d2btoa2
PDB Entry: 2bto (more details), 2.5 Å
PDB Description: structure of btuba from prosthecobacter dejongeii
PDB Compounds: (A:) tubulin btubaSCOPe Domain Sequences for d2btoa2:
Sequence, based on SEQRES records: (download)
>d2btoa2 d.79.2.1 (A:253-432) Tubulin alpha-subunit {Prosthecobacter dejongeii [TaxId: 48465]}
eislrelltnlvpqpslhflmcafapltppdrskfeelgieemikslfdngsvfaacspm
egrflstavlyrgimedkpladaalaamreklpltywiptafkigyveqpgishrksmvl
lannteiarvldrichnfdklwqrkafanwylnegmseeqinvlrasaqelvqsyqvaee
Sequence, based on observed residues (ATOM records): (download)
>d2btoa2 d.79.2.1 (A:253-432) Tubulin alpha-subunit {Prosthecobacter dejongeii [TaxId: 48465]}
eislrelltnlvpqpslhflmcafapltppdelgieemikslfdngsvfaacspmegrfl
stavlyrgipladaalaamreklpltywiptafkigyveqpgishrksmvllannteiar
vldrichnfdklwqrkafanwylnegmseeqinvlrasaqelvqsyqvaee
SCOPe Domain Coordinates for d2btoa2:
Click to download the PDB-style file with coordinates for d2btoa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2btoa2:
- d2btoa2 first appeared in SCOP 1.75
- d2btoa2 appears in SCOPe 2.06
- d2btoa2 appears in the current release, SCOPe 2.08
View in 3D
