Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) |
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
Protein Tubulin alpha-subunit [55311] (3 species) |
Species Prosthecobacter dejongeii [TaxId:48465] [160500] (2 PDB entries) Uniprot Q8GCC5 253-432 bacterial tubulin BtubA |
Domain d2btoa2: 2bto A:253-432 [145010] Other proteins in same PDB: d2btoa1, d2btob1, d2btot_ complexed with gtp |
PDB Entry: 2bto (more details), 2.5 Å
SCOPe Domain Sequences for d2btoa2:
Sequence, based on SEQRES records: (download)
>d2btoa2 d.79.2.1 (A:253-432) Tubulin alpha-subunit {Prosthecobacter dejongeii [TaxId: 48465]} eislrelltnlvpqpslhflmcafapltppdrskfeelgieemikslfdngsvfaacspm egrflstavlyrgimedkpladaalaamreklpltywiptafkigyveqpgishrksmvl lannteiarvldrichnfdklwqrkafanwylnegmseeqinvlrasaqelvqsyqvaee
>d2btoa2 d.79.2.1 (A:253-432) Tubulin alpha-subunit {Prosthecobacter dejongeii [TaxId: 48465]} eislrelltnlvpqpslhflmcafapltppdelgieemikslfdngsvfaacspmegrfl stavlyrgipladaalaamreklpltywiptafkigyveqpgishrksmvllannteiar vldrichnfdklwqrkafanwylnegmseeqinvlrasaqelvqsyqvaee
Timeline for d2btoa2: