Lineage for d2btja_ (2btj A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2940626Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2940627Protein automated matches [190526] (26 species)
    not a true protein
  7. 2941021Species Lobophyllia hemprichii [TaxId:46758] [187486] (25 PDB entries)
  8. 2941069Domain d2btja_: 2btj A: [163163]
    automated match to d1mova_

Details for d2btja_

PDB Entry: 2btj (more details), 2 Å

PDB Description: fluorescent protein eosfp - red form
PDB Compounds: (A:) green to red photoconvertible gpf-like protein eosfp

SCOPe Domain Sequences for d2btja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2btja_ d.22.1.0 (A:) automated matches {Lobophyllia hemprichii [TaxId: 46758]}
ggaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltta
fxnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrfhg
vnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdfrttykakek
gvklpgyhfvdhcieilshdkdynkvklyehavahsglpd

SCOPe Domain Coordinates for d2btja_:

Click to download the PDB-style file with coordinates for d2btja_.
(The format of our PDB-style files is described here.)

Timeline for d2btja_: