Lineage for d2btia_ (2bti A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2825104Fold b.151: CsrA-like [117129] (1 superfamily)
    sandwich; 10 strands in 2 sheets; intertwined dimer (segment-swapped, 5-stranded greek-key sandwich?)
  4. 2825105Superfamily b.151.1: CsrA-like [117130] (2 families) (S)
  5. 2825106Family b.151.1.1: CsrA-like [117131] (2 proteins)
    Pfam PF02599
  6. 2825114Protein automated matches [190528] (4 species)
    not a true protein
  7. 2825150Species Yersinia enterocolitica [TaxId:630] [187488] (1 PDB entry)
  8. 2825151Domain d2btia_: 2bti A: [163161]
    automated match to d1vpza_
    complexed with act, so4

Details for d2btia_

PDB Entry: 2bti (more details), 2 Å

PDB Description: structure-function studies of the rmsa csra post-transcriptional global regulator protein family reveals a class of rna-binding structure
PDB Compounds: (A:) carbon storage regulator homolog

SCOPe Domain Sequences for d2btia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2btia_ b.151.1.1 (A:) automated matches {Yersinia enterocolitica [TaxId: 630]}
smliltrrvgetlmigdevtvtvlgvkgnqvrigvnapkevsvhreeiyqriqaeksqp

SCOPe Domain Coordinates for d2btia_:

Click to download the PDB-style file with coordinates for d2btia_.
(The format of our PDB-style files is described here.)

Timeline for d2btia_: