Lineage for d2bsya2 (2bsy A:121-256)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.85: beta-clip [51268] (7 superfamilies)
double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
Superfamily b.85.4: dUTPase-like [51283] (2 families) 
forms tight trimer through an additional beta-sheet in each subunit
subunit beta-sheets are orthogonally packed around the three-fold axis
Family b.85.4.1: dUTPase-like [51284] (5 proteins) 
Protein Monomeric viral dUTPase [141655] (1 species)
related to the trimeric dUTPase domain by domain duplication, fusion and partial deletion; retains only one of the three ancestral active sitesSpecies Epstein-Barr virus [TaxId:10376] [141656] (2 PDB entries)
Uniprot P03195 121-256! Uniprot P03195 4-116
Human herpesvirus 4
Domain d2bsya2: 2bsy A:121-256 [129130]
includes domain 2, rudiment domain 3 and C-terminal arm
complexed with so4, ump
Details for d2bsya2
PDB Entry: 2bsy (more details), 1.5 Å
PDB Description: epstein barr virus dutpase
PDB Compounds: (A:) deoxyuridine 5'-triphosphate nucleotidohydrolaseSCOPe Domain Sequences for d2bsya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bsya2 b.85.4.1 (A:121-256) Monomeric viral dUTPase {Epstein-Barr virus [TaxId: 10376]}
gpinhpqypgdvgldvslpkdlalfphqtvsvtltvpppsiphhrptifgrsglamqgil
vkpcrwrrggvdvsltnfsdqtvflnkyrrfcqlvylhkhhltsfysphsdagvlgprsl
frwasctfeevpslam
SCOPe Domain Coordinates for d2bsya2:
Click to download the PDB-style file with coordinates for d2bsya2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2bsya2:
- d2bsya2 first appeared in SCOP 1.73
- d2bsya2 appears in SCOPe 2.07
View in 3D
