Lineage for d2boka1 (2bok A:16-244)
- Root: SCOP 1.75
Class b: All beta proteins [48724] (174 folds) 
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
barrel, closed; n=6, S=8; greek-key
duplication: consists of two domains of the same foldSuperfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins) 
Protein Coagulation factor Xa, protease domain [50574] (2 species) Species Human (Homo sapiens) [TaxId:9606] [50575] (75 PDB entries)
Uniprot P00742 235-467
Domain d2boka1: 2bok A:16-244 [128916]
Other proteins in same PDB: d2bokl1
automatically matched to d1c5md_
complexed with 784, na; mutant
Details for d2boka1
PDB Entry: 2bok (more details), 1.64 Å
PDB Description: factor xa - cation
PDB Compounds: (A:) coagulation factor xSCOP Domain Sequences for d2boka1:
Sequence, based on SEQRES records: (download)
>d2boka1 b.47.1.2 (A:16-244) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]}
ivggqeckdgecpwqallineenegfcggtilsefyiltaahclyqakrfkvrvgdrnte
qeeggeavhevevvikhnrftketydfdiavlrlktpitfrmnvapaclperdwaestlm
tqktgivsgfgrthekgeqstrlkmlevpyvdrnscklsssfiitqnmfcagydtkqeda
cqgdsggphvtrfkdtyfvtgivswgegcarkgkygiytkvtaflkwidrsmkt
Sequence, based on observed residues (ATOM records): (download)
>d2boka1 b.47.1.2 (A:16-244) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]}
ivggqeckdgecpwqallineenegfcggtilsefyiltaahclyqakrfkvrvgavhev
evvikhnrftketydfdiavlrlktpitfrmnvapaclperdwaestlmtqktgivsgfg
rthekgeqstrlkmlevpyvdrnscklsssfiitqnmfcagydtkqedacqgdsggphvt
rfkdtyfvtgivswgegcarkgkygiytkvtaflkwidrsmkt
SCOP Domain Coordinates for d2boka1:
Click to download the PDB-style file with coordinates for d2boka1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2boka1:
- d2boka1 first appeared in SCOP 1.73
- d2boka1 is called d2boka_ in SCOPe 2.01
- d2boka1 appears in the current release, SCOPe 2.08, called d2boka_
View in 3D
