Lineage for d2bo9a1 (2bo9 A:4-307)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1608160Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 1609338Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 1609339Family c.56.5.1: Pancreatic carboxypeptidases [53188] (5 proteins)
  6. 1609340Protein Carboxypeptidase A [53189] (4 species)
  7. 1609394Species Human (Homo sapiens) [TaxId:9606] [53192] (5 PDB entries)
  8. 1609395Domain d2bo9a1: 2bo9 A:4-307 [128897]
    Other proteins in same PDB: d2bo9b1, d2bo9b2, d2bo9d1, d2bo9d2
    Procarboxypeptidase A4
    complexed with acn, mpd, nag, val, zn

Details for d2bo9a1

PDB Entry: 2bo9 (more details), 1.6 Å

PDB Description: human carboxypeptidase a4 in complex with human latexin.
PDB Compounds: (A:) carboxypeptidase a4

SCOPe Domain Sequences for d2bo9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bo9a1 c.56.5.1 (A:4-307) Carboxypeptidase A {Human (Homo sapiens) [TaxId: 9606]}
snnfnygayhsleaiyhemdniaadfpdlarrvkighsfenrpmyvlkfstgkgvrrpav
wlnagihsrewisqataiwtarkivsdyqrdpaitsilekmdifllpvanpdgyvytqtq
nrlwrktrsrnpgsscigadpnrnwnasfagkgasdnpcsevyhgphansevevksvvdf
iqkhgnfkgfidlhsysqllmypygysvkkapdaeeldkvarlaakalasvsgteyqvgp
tcttvypasgssidwaydngikfaftfelrdtgtygfllpanqiiptaeetwlglktime
hvrdn

SCOPe Domain Coordinates for d2bo9a1:

Click to download the PDB-style file with coordinates for d2bo9a1.
(The format of our PDB-style files is described here.)

Timeline for d2bo9a1: