Lineage for d2bo4a1 (2bo4 A:2-382)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2149496Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2149497Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2150354Family c.68.1.18: MGS-like [142691] (2 proteins)
    contains extra C-terminal all-alpha subdomain: 5 helices, orthogonal array
  6. 2150355Protein Mannosylglycerate synthase, MGS [142692] (1 species)
  7. 2150356Species Rhodothermus marinus [TaxId:29549] [142693] (9 PDB entries)
    Uniprot Q9RFR0 2-382
  8. 2150357Domain d2bo4a1: 2bo4 A:2-382 [128869]
    Other proteins in same PDB: d2bo4b_, d2bo4c_, d2bo4d_, d2bo4e_, d2bo4f_
    complexed with flc

Details for d2bo4a1

PDB Entry: 2bo4 (more details), 1.95 Å

PDB Description: dissection of mannosylglycerate synthase: an archetypal mannosyltransferase
PDB Compounds: (A:) mannosylglycerate synthase

SCOPe Domain Sequences for d2bo4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bo4a1 c.68.1.18 (A:2-382) Mannosylglycerate synthase, MGS {Rhodothermus marinus [TaxId: 29549]}
slvvfpfkhehpevllhnvrvaaahprvhevlcigyerdqtyeaveraapeisratgtpv
svrlqerlgtlrpgkgdgmntalryfleetqwerihfydaditsfgpdwitkaeeaadfg
yglvrhyfprastdamitwmitrtgfallwphtelswieqplggellmrrevaamlyede
rvrrrsdwgidtlytfvtvqqgvsiyecyipegkahrlygglddlrtmlvecfaaiqslq
hevvgqpaihrqehphrvpvhiaervgydveatlhrlmqhwtprqvellelfttpvregl
rtcqrrpafnfmdemawaatyhvllehfqpgdpdweellfklwttrvlnytmtvalrgyd
yaqqylyrmlgryryqaalen

SCOPe Domain Coordinates for d2bo4a1:

Click to download the PDB-style file with coordinates for d2bo4a1.
(The format of our PDB-style files is described here.)

Timeline for d2bo4a1: