Lineage for d2bmza_ (2bmz A:)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.77: beta-Prism I [51091] (3 superfamilies)
consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
duplication: has internal pseudo threefold symmetrySuperfamily b.77.3: Mannose-binding lectins [51101] (2 families) 
Family b.77.3.0: automated matches [191397] (1 protein)
not a true familyProtein automated matches [190516] (2 species)
not a true protein
Species Musa acuminata [TaxId:4641] [187471] (10 PDB entries) 
Domain d2bmza_: 2bmz A: [163128]
automated match to d1c3ka_
complexed with cd, so4, xlm
Details for d2bmza_
PDB Entry: 2bmz (more details), 2.4 Å
PDB Description: banana lectin bound to xyl-b1,3 man-a-o-methyl (xm)
PDB Compounds: (A:) ripening-associated proteinSCOPe Domain Sequences for d2bmza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bmza_ b.77.3.0 (A:) automated matches {Musa acuminata [TaxId: 4641]}
mngaikvgawggnggsafdmgpayriisvkifsgdvvdgvdvtftyygktetrhyggsgg
tpheivlqegeylvgmagevanyhgavvlgklgfstnkkaygpfgntggtpfslpiaagk
isgffgrggkfldaigvylep
SCOPe Domain Coordinates for d2bmza_:
Click to download the PDB-style file with coordinates for d2bmza_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2bmza_:
- d2bmza_ first appeared in SCOPe 2.01
- d2bmza_ appears in SCOPe 2.04
- d2bmza_ appears in SCOPe 2.06
- d2bmza_ appears in the current release, SCOPe 2.08
View in 3D
