Lineage for d2bmoa1 (2bmo A:3-152)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2391958Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 2391959Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 2392087Family b.33.1.2: Ring hydroxylating alpha subunit ISP domain [50033] (6 proteins)
  6. 2392155Protein Nitrobenzene dioxygenase alpha subunit, NBDO-alpha [141180] (1 species)
  7. 2392156Species Comamonas sp. JS765 [TaxId:58226] [141181] (3 PDB entries)
    Uniprot Q8RTL4 3-152
  8. 2392157Domain d2bmoa1: 2bmo A:3-152 [128804]
    Other proteins in same PDB: d2bmoa2, d2bmob1
    complexed with edo, eoh, fe, fes, ni

Details for d2bmoa1

PDB Entry: 2bmo (more details), 1.2 Å

PDB Description: the crystal structure of nitrobenzene dioxygenase
PDB Compounds: (A:) oxygenase-alpha nbdo

SCOPe Domain Sequences for d2bmoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bmoa1 b.33.1.2 (A:3-152) Nitrobenzene dioxygenase alpha subunit, NBDO-alpha {Comamonas sp. JS765 [TaxId: 58226]}
yqnlvseagltqkllihgdkelfqhelktifarnwlflthdslipspgdyvkakmgvdev
ivsrqndgsvraflnvcrhrgktlvhaeagnakgfvcgyhgwgygsngelqsvpfekely
gdaikkkclglkevpriesfhgfiygcfda

SCOPe Domain Coordinates for d2bmoa1:

Click to download the PDB-style file with coordinates for d2bmoa1.
(The format of our PDB-style files is described here.)

Timeline for d2bmoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bmoa2
View in 3D
Domains from other chains:
(mouse over for more information)
d2bmob1