Lineage for d2bmfa1 (2bmf A:483-618)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) 
division into families based on beta-sheet topologies
Family c.37.1.14: RNA helicase [52724] (4 proteins)
duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension
Protein Dengue virus helicase [142328] (1 species) Species Dengue virus type 2 [TaxId:11060] [142329] (2 PDB entries)
Uniprot Q91H74 1653-1957! Uniprot Q91H74 1958-2093
Domain d2bmfa1: 2bmf A:483-618 [128791]
automated match to d2bhra1
Details for d2bmfa1
PDB Entry: 2bmf (more details), 2.41 Å
PDB Description: dengue virus rna helicase at 2.4a
PDB Compounds: (A:) RNA helicaseSCOPe Domain Sequences for d2bmfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bmfa1 c.37.1.14 (A:483-618) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]}
edcahwkeakmlldnintpegiipsmfeperekvdaidgeyrlrgearktfvdlmrrgdl
pvwlayrvaaeginyadrrwcfdgvknnqileenveveiwtkegerkklkprwldariys
dplalkefkefaagrk
SCOPe Domain Coordinates for d2bmfa1:
Click to download the PDB-style file with coordinates for d2bmfa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2bmfa1:
- d2bmfa1 first appeared in SCOP 1.73
- d2bmfa1 appears in SCOPe 2.04
- d2bmfa1 appears in SCOPe 2.06
- d2bmfa1 appears in the current release, SCOPe 2.08
View in 3D
